PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C004535P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family G2-like
Protein Properties Length: 501aa    MW: 55070.2 Da    PI: 7.0298
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C004535P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.26.6e-32286341156
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     k+r++W+p+LH+rFv+a++ LGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  MELO3C004535P1 286 KARRCWSPDLHRRFVNALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 341
                     68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.73E-17283344IPR009057Homeodomain-like
PROSITE profilePS5129413.355283343IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.6E-28284344IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-26286341IPR006447Myb domain, plants
PfamPF002499.0E-7288339IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 501 aa     Download sequence    Send to blast
MPSPPELSLD CKPHSYSMLL KSFVSEHHQV AITTTTTNNN NTQDHQQQQQ HHSSSQNQQL  60
QDLLSCLEAE RLKIDAFKRE LPLCMQLLTN ALETSRQQLQ GSRSVNSNNN NDENDHQNSQ  120
KPILEEFIPL KQTTSESSDQ TLTNNISDKA NWMISAQLWS QTNNNSTNII DETKPINLSS  180
SKQQQQPIVH HHQIGLIPKL QRNNNNNNNN NNQNNGGAFL PFSKDRILHN STSSNSSHLP  240
DLALAATTAA DFADNDGNNN NSNNNSTVVV NNNNNTTNST NQTHRKARRC WSPDLHRRFV  300
NALQMLGGSQ VATPKQIREL MKVDGLTNDE VKSHLQKYRL HTRRPSPSPQ AAGAPAPQLV  360
VLGGIWVPPE YATAAAHGGA PALYGPHPTT YCAPPVHQDF YPPPPLPHHQ LHHQHALHQQ  420
LHMYKAAATA QAHSSPESDG RGNGDRSESI EDGGKSESGS WKVESGGENN GGTGERKGNL  480
AALRQEAGDE SNGSEITLKF *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818470.0LN681847.1 Cucumis melo genomic scaffold, anchoredscaffold00003.
GenBankLN7132590.0LN713259.1 Cucumis melo genomic chromosome, chr_5.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008457979.10.0PREDICTED: GATA zinc finger domain-containing protein 16
TrEMBLA0A0A0LKW20.0A0A0A0LKW2_CUCSA; Uncharacterized protein
STRINGPOPTR_0018s06410.11e-151(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF54663455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.19e-77G2-like family protein